|
|
Scenerockers.net is a domain which has a global ranking of 106293 which enables its users to search about SceneRockers.Net! - Download Tamil Hindi Telugu Movies - Watch Online Tamil Movies - Tamil Blurays - Tamil DVD's - Download Hindi Movies - Watch Hindi Movies Online - Download Telugu Movies - Watch Telugu Movies Online - Download HD Movies - Vadivelu Comedies Watch Online - Download Malayalam Movies - Watch Movies Online - More & More. This site's google pr or page rank is 0 which shows its popularity in the world among other domains. 108.162.192.140 Ip address is assigned to the domain Scenerockers.net which shows that its server is hosted in and this city is located inside United States. our information shows other meta tags report and child safety, trust worthiness, scam check, advice for Scenerockers.net etc below. |
|
|
This page was last updated 46 Days Ago
|
|
|
Title Headline:
SceneRockers.Net! - Download Tamil Hindi Telugu Movies - Watch Online Tamil Movies - Tamil Blurays - Tamil DVD's - Download Hindi Movies - Watch Hindi Movies Online - Download Telugu Movies - Watch Telugu Movies Online - Download HD Movies - Vadivelu Comedies Watch Online - Download Malayalam Movies - Watch Movies Online - More & More
|
|
Brief Description:
Isaithai.Com Ithu Oru Isaiyin Thai Madi - Tamil Hindi Telugu Malayalam - No1 Entertainment Paradise
|
|
Categories (Meta keywords):
isaithaiteamistteam,istist,kingtorrentsnew,tamil,moviestamil,mp3shigh,quality,ripsvijayajithsuryarajinikamalendiranvettaikaransurakavalkaranmadrasapatinamayngarandvddvd-ripvcdfirst,on,nettc1cdripHD,720ptamilhinditelugumalayalamdubbed,tamil,moviesanushkasimran.sherinkathal,solla,vanthen.enavaleyaradi,nee,mohinisanthosh,subramaniyamtv,showstamil-blurays1080p120pisaithaicreditsithuoruisaiyinthaimadiaudiosongsvideosongsgallerycinema,postersnanbanendhirantamilwiretamilkeygoogleokokoru,kal,oru,kannaditamil,torrentsdownloadwatch,onlinetamil,moviesvadivelu,tamil,songsblurays,ayngarandvdsayngaran,mp3,songssearch,tamil,moviestamil,torrent,movie,music,dvd-r,mp3,tamiltorrent,hindi,movie,serial,hindi,movies,free,new,movies,free,movie,tamil,torrents,old,movies,new,movie,dvdrip
|
|
|
Malware Warning:
Scenerockers.net is safe for browsing and is a legit and trustworthy website which is not involved in any scam or phishing. Scenerockers.net is not a scam website. Scenerockers.net is not a fake website.
|
|
| =-=-=-= Registration Service Provided By: Namecheap.com Contact: support@namecheap.com Visit: http://namecheap.com Domain name: scenerockers.net Registrant Contact: WhoisGuard WhoisGuard Protected () Fax: 11400 W. Olympic Blvd. Suite 200 Los Angeles, CA 90064 US Administrative Contact: WhoisGuard WhoisGuard Protected (423b46bd4772400***62443c02f150587.protect@whoisguard.com) +1.6613102107 Fax: +1.6613102107 11400 W. Olympic Blvd. Suite 200 Los Angeles, CA 90064 US Technical Contact: WhoisGuard WhoisGuard Protected (423b46bd4772400***62443c02f150587.protect@whoisguard.com) +1.6613102107 Fax: +1.6613102107 11400 W. Olympic Blvd. Suite 200 Los Angeles, CA 90064 US Status: Locked Name Servers: max.ns.cloudflare.com rita.ns.cloudflare.com Creation date: 01 Jan 2011 11:25:00 Expiration date: 01 Jan 2014 06:25:00 =-=-=-= The data in this whois database is provided to you for information purposes only, that is, to ***ist you in obtaining information about or related to a domain name registration record. We make this information available "as is," and do not guarantee its accuracy. By submitting a whois query, you agree that you will use this data only for lawful purposes and that, under no cir***stances will you use this data to: (1) enable high volume, automated, electronic processes that stress or load this whois database system providing you this information; or (2) allow, enable, or otherwise support the ***mission of m*** unsolicited, commercial advertising or solicitations via direct mail, electronic mail, or by telephone. The compilation, repackaging, dissemination or other use of this data is expressly prohi***ted without prior written consent from us. We reserve the right to modify these terms at any time. By submitting this query, you agree to a***de by these terms. Version 6.3 4/3/2002 |
|
|
Scenerockers.net is only using the ip address: 108.162.192.140
|
|
||
|
|
|
|
|
|
||||||||||||||
|
|
||||||||||||||
|
|
|
| Url | Ip address |
| scenerockers.com | 38.101.213.235 |
|
|
have join helpencoded indian site rip's postrequest generalever call quality donate aravindthreadsnever musiclink animation anandan readpoll ganesh problem rules kids dvd-todayreleasesmoderators forums dvd-rip'sdubbed ananthu audio online this josonjohndinesh galleryvisit movies memberinformation show songskangalenkangal userskarthi balaji srsh report scenerockerstelugu rockers blu-ray beforeguru manrath hi-def anand search moviebetter raga introduce donation ashok games goal suara registercontains news sectionhindi lastreviews pleaseabove siva videosbala your cinemaupscaled govindsr members afarizpostsyourself hererips bhagavan kishshaa releaserswant will wallpapers dvd'swallpaper bhanu guests viewingameeraym tamilfind latest karthicrractive otherforumhours baskarsuperstar |