|
|
Netjobs247.com is a domain which has a global ranking of 1455311 which enables its users to search about Part Time Job | Easy Online Jobs for Indians | Work from home. This site's google pr or page rank is 0 which shows its popularity in the world among other domains. 96.125.174.8 Ip address is assigned to the domain Netjobs247.com which shows that its server is hosted in Mount Laurel and this city is located inside United States. our information shows other meta tags report and child safety, trust worthiness, scam check, advice for Netjobs247.com etc below. |
|
|
This page was last updated 13 Days Ago
|
|
|
Title Headline:
Part Time Job | Easy Online Jobs for Indians | Work from home
|
|
Brief Description:
Part Time Job Earn Money online Work from Home
|
|
Categories (Meta keywords):
Part,Time,Job,online,jobs,part,time,jobs,home,based,jobs
|
|
|
Malware Warning:
Netjobs247.com is safe for browsing and is a legit and trustworthy website which is not involved in any scam or phishing. Netjobs247.com is not a scam website. Netjobs247.com is not a fake website.
|
|
|
|
|
|||||||||||||||||||||||||||||||||||||
|
|
|||||||||||
|
|
|
|
No data found. |
|
| Registration Service Provided By: ***GROCK Domain Name: NETJOBS247.COM Registration Date: 26-Sep-2012 Expiration Date: 26-Sep-2013 Status:LOCKED Note: This Domain Name is currently Locked. This feature is provided to protect against fraudulent acquisition of the domain name, as in this status the domain name cannot be ***ferred or modified. Name Servers: ns2971.hostgator.com ns2972.hostgator.com Registrant Contact Details: PrivacyProtect.org Domain Admin (contact@privacyprotect.org) ID#10760, PO Box 16 Note - Visit PrivacyProtect.org to contact the domain owner/operator Nobby Beach Queensland,QLD 42*** AU Tel. +45.36946676 Administrative Contact Details: PrivacyProtect.org Domain Admin (contact@privacyprotect.org) ID#10760, PO Box 16 Note - Visit PrivacyProtect.org to contact the domain owner/operator Nobby Beach Queensland,QLD 42*** AU Tel. +45.36946676 Technical Contact Details: PrivacyProtect.org Domain Admin (contact@privacyprotect.org) ID#10760, PO Box 16 Note - Visit PrivacyProtect.org to contact the domain owner/operator Nobby Beach Queensland,QLD 42*** AU Tel. +45.36946676 ***lling Contact Details: PrivacyProtect.org Domain Admin (contact@privacyprotect.org) ID#10760, PO Box 16 Note - Visit PrivacyProtect.org to contact the domain owner/operator Nobby Beach Queensland,QLD 42*** AU Tel. +45.36946676 PRIVACYPROTECT.ORG is providing privacy protection services to this domain name to protect the owner from spam and phishing attacks. PrivacyProtect.org is not responsible for any of the activities ***ociated with this domain name. If you wish to report any *** concerning the usage of this domain name, you may do so at http://privacyprotect.org/contact. We have a stringent *** policy and any complaint will be actioned within a short period of time. The data in this whois database is provided to you for information purposes only, that is, to ***ist you in obtaining information about or related to a domain name registration record. We make this information available "as is", and do not guarantee its accuracy. By submitting a whois query, you agree that you will use this data only for lawful purposes and that, under no cir***stances will you use this data to: (1) enable high volume, automated, electronic processes that stress or load this whois database system providing you this information; or (2) allow, enable, or otherwise support the ***mission of m*** unsolicited, commercial advertising or solicitations via direct mail, electronic mail, or by telephone. The compilation, repackaging, dissemination or other use of this data is expressly prohi***ted without prior written consent from us. The Registrar of record is ***gRock Solutions Ltd. We reserve the right to modify these terms at any time. By submitting this query, you agree to a***de by these terms. |
|
How popular is Netjobs247.com - See Below Graph
Importance of Google trends is that these graphs shows the searches related to the site Netjobs247.com. This graph is powered by google trends. This trend data contains almost the data for the past 6 years. How popular is Netjobs247.com?. This graph will show you. You don't like figures, everybody likes to see graph for such complex data which cannot be easily guessed exactly. |
|
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|
|
|
||
|
|
|
|
|
|
||||||||||||||
|
|
||||||||||||||
|
|
|
| No similar sites found. Sorry for that. |
|
amountgive needpersonal kumar doing members step limit days manychoice collect highly form secondstimelikedifferent enoughhavenamecharges types received internetread onlyanswer link positive look whichcontact earning what muchhindi monthplease wrongnext increase online theiryourreceive belowwhere being filled payment alsousername somefees could eachthatwindow proof worker number free worktarget home just account registrationfast know part theredepends stay right hoursmumbai used company lastqualification firststarted netjobs joining want least wheneasyclickthesepackagethemdemo multinational moresurveyopenwould emailsworld important with today dailythishouse about directly links whether earnings informationsend faqs fromstatus earned accordingmeans advertisers naveen still website nothing questionincome startnote formshereafter bank happybrowsing viewnegative advertising providewillfillbecausepaiddollars limited spend inbox parents companieseither goodeasily without veryearndetail minimum cheque |